General Information

  • ID:  hor006618
  • Uniprot ID:  P0C0P5
  • Protein name:  Neuropeptide S precursor
  • Gene name:  NPS
  • Organism:  Bos taurus (Bovine)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0032230 positive regulation of synaptic transmission, GABAergic; GO:0045760 positive regulation of action potential; GO:0051968 positive regulation of synaptic transmission, glutamatergic
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HPISSSKVPGKSDYFVILLNSCPTRMDRRVGLDFLKPILEKTLMKRSFRNGVGTGMKKTSFRRAKS
  • Length:  66(24-89)
  • Propeptide:  MIGSLKFNFILFLLISTMHMFWCHPISSSKVPGKSDYFVILLNSCPTRMDRRVGLDFLKPILEKTLMKRSFRNGVGTGMKKTSFRRAKS
  • Signal peptide:  MIGSLKFNFILFLLISTMHMFWC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Modulates arousal and anxiety. May play an important anorexigenic role. Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C0P5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006618_AF2.pdbhor006618_ESM.pdb

Physical Information

Mass: 864539 Formula: C331H551N99O90S4
Absent amino acids: QW Common amino acids: KSR
pI: 11.69 Basic residues: 16
Polar residues: 21 Hydrophobic residues: 18
Hydrophobicity: -47.73 Boman Index: -15017
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 72.27
Instability Index: 4783.94 Extinction Coefficient cystines: 1490
Absorbance 280nm: 22.92

Literature

  • PubMed ID:  NA
  • Title:  NA